-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNPO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human TNPO1 (NP_002261.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNPO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human TNPO1 (NP_002261.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05885A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNPO1 |
| Target Synonyms | MIP; TRN; IPO2; MIP1; KPNB2; TNPO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human TNPO1 (NP_002261.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFIRPWCTSLRNIRDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQVGDENWRRFSDQFPLPLKERLAAFYGV | Uniprot ID | Q92973 |
Uniprot Id
Q92973
Target Species
Human
Target Name
TNPO1
Target Full Name
Transportin-1
Target Function
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the heterogeneous nuclear ribonucleoproteins (hnRNP), A1 and A2 and mediates their nuclear import. Appears also to be involved in hnRNP A1/A2 nuclear export. Mediates the nuclear import of ribosomal proteins RPL23A, RPS7 and RPL5. Binds to a beta-like import receptor binding (BIB) domain of RPL23A. In vitro, mediates nuclear import of H2A, H2B, H3 and H4 histones, and SRP19. Mediates nuclear import of ADAR/ADAR1 isoform 1 and isoform 5 in a RanGTP-dependent manner.; (Microbial infection) In case of HIV-1 infection, binds and mediates the nuclear import of HIV-1 Rev.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Importin beta family, Importin beta-2 subfamily
Target Synonyms
Importin 2; Importin beta 2; Importin beta-2; IPO 2; IPO2; Karyopherin (importin) beta 2; Karyopherin beta 2; Karyopherin beta-2; KPN B2; KPNB 2; KPNB2; M9 interacting protein; M9 region interacting protein; M9 region interaction protein; MIP 1; MIP; MIP1; OTTHUMP00000126960; OTTHUMP00000222024; OTTHUMP00000226224; TNPO 1; Tnpo1; TNPO1_HUMAN; Transportin 1; Transportin; Transportin-1; Transportin1; TRN
Target Background
This gene encodes the beta subunit of the karyopherin receptor complex which interacts with nuclear localization signals to target nuclear proteins to the nucleus. The karyopherin receptor complex is a heterodimer of an alpha subunit which recognizes the nuclear localization signal and a beta subunit which docks the complex at nucleoporins. Alternate splicing of this gene results in several transcript variants encoding different proteins.
Notification