-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNRC6A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TNRC6A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08659A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNRC6A |
| Target Synonyms | GW1; FAME6; GW182; TNRC6; CAGH26; TNRC6A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 950-1050 of human TNRC6A (NP_055309.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDIVGSWGIPPATGKPPGTGWLGGPIPAPAKEEEPTGWEEPSPESIRRKMEIDDGTSAWGDPSKYNYKNVNMWNKNVPNGNSRSDQQAQVHQLLTPASAIS | Uniprot ID | Q8NDV7 |
Uniprot Id
Q8NDV7
Target Species
Human
Target Name
TNRC6A
Target Full Name
Trinucleotide repeat-containing gene 6A protein
Target Function
Plays a role in RNA-mediated gene silencing by both micro-RNAs (miRNAs) and short interfering RNAs (siRNAs). Required for miRNA-dependent repression of translation and for siRNA-dependent endonucleolytic cleavage of complementary mRNAs by argonaute family proteins. As a scaffolding protein, associates with argonaute proteins bound to partially complementary mRNAs, and can simultaneously recruit CCR4-NOT and PAN deadenylase complexes.
Target Subcellular Location
Cytoplasm, P-body.
Target Protein Families
GW182 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
CAG repeat protein 26; CAGH26; DKFZp666E117; EDIE ; EMSY interactor protein; FLJ22043; Glycine tryptophan protein of 182 kDa; Glycine-tryptophan protein of 182 kDa; GW1; GW182; GW182 autoantigen; Hypothetical protein DKFZp566M143 ; KIAA1460; MGC75384; OTTHUMP00000122485; OTTHUMP00000195164; OTTHUMP00000195165; Protein GW1; TNR6A_HUMAN; TNRC 6A; TNRC6; Tnrc6a; Trinucleotide repeat containing 6A; Trinucleotide repeat containing gene 6A protein; Trinucleotide repeat-containing gene 6A protein
Target Background
This gene encodes a member of the trinucleotide repeat containing 6 protein family. The protein functions in post-transcriptional gene silencing through the RNA interference (RNAi) and microRNA pathways. The protein associates with messenger RNAs and Argonaute proteins in cytoplasmic bodies known as GW-bodies or P-bodies. Inhibiting expression of this gene delocalizes other GW-body proteins and impairs RNAi and microRNA-induced gene silencing.
Notification