Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TNS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TNS1 (NP_072174.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TNS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TNS1 (NP_072174.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06932A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TNS1 |
| Target Synonyms | TNS; MXRA6; MST091; MST122; MST127; MSTP091; MSTP122; MSTP127; PPP1R155; TNS1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TNS1 (NP_072174.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVV | Uniprot ID | Q9HBL0 |
Uniprot Id
Q9HBL0
Target Species
Human
Target Name
TNS1
Target Full Name
Tensin-1
Target Function
Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.
Target Subcellular Location
Cell surface. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Note=Localized at cell periphery preferentially to fibrillar adhesions than focal adhesions. Translocates from the cell edge to cell center in an ITGB1BP1-dependent manner.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
matrix-remodelling associated 6; Matrix-remodelling-associated protein 6; MGC88584; MST091; MST122; MST127; MSTP091; MSTP122; MSTP127; MXRA6; TENS1_HUMAN; Tensin; Tensin-1; TNS; TNS1
Target Background
The protein encoded by this gene localizes to focal adhesions, regions of the plasma membrane where the cell attaches to the extracellular matrix. This protein crosslinks actin filaments and contains a Src homology 2 (SH2) domain, which is often found in molecules involved in signal transduction. This protein is a substrate of calpain II. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
