Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-493 of human TOM1 (NP_001129204.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-493 of human TOM1 (NP_001129204.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOM1 |
| Target Synonyms | IMD85; TOM1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 314-493 of human TOM1 (NP_001129204.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEGKFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL | Uniprot ID | O60784 |
Uniprot Id
O60784
Target Species
Human
Target Name
TOM1
Target Full Name
Target of Myb1 membrane trafficking protein
Target Function
May be involved in intracellular trafficking. Probable association with membranes.
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein.
Target Protein Families
TOM1 family
Target Tissue Specificity
Widely expressed. Highly expressed in skeletal muscle, heart, placenta and liver.
Target Synonyms
TOM1; Target of Myb protein 1
Target Background
This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
