Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOM1L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human TOM1L1 (NP_005477.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOM1L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human TOM1L1 (NP_005477.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06979A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOM1L1 |
| Target Synonyms | SRCASM; TOM1L1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, HT-29, Rat kidney, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human TOM1L1 (NP_005477.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QERIMDLLVVVENEDVTVELIQVNEDLNNAILGYERFTRNQQRILEQNKNQKEATNTTSEPSAPSQDLLDLSPSPRMPRATLGELNTMNNQLSGLNFSLPS | Uniprot ID | O75674 |
Uniprot Id
O75674
Target Species
Human
Target Name
TOM1L1
Target Full Name
TOM1-like protein 1
Target Function
Probable adapter protein involved in signaling pathways. Interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. May promote FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
Target Subcellular Location
Golgi apparatus, Golgi stack. Endosome membrane. Cytoplasm. Membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
TOM1 family
Target Synonyms
2310045L10Rik; C80573; OK/KNS CL.3; Src activating and signaling molecule; Src activating and signaling molecule protein; Src-activating and signaling molecule protein; SRCASM; Target of Myb like protein 1; Target of Myb-like protein 1; Target of myb1 (chicken) homolog like 1; Target of myb1 (chicken) like 1; Target of myb1 like 1; TM1L1_HUMAN; TOM1 L1; TOM1 like protein 1; TOM1-like protein 1; TOM1L1; TOM1L1 protein
Target Background
Enables clathrin binding activity and protein kinase binding activity. Involved in negative regulation of mitotic nuclear division; positive regulation of protein phosphorylation; and signal transduction. Located in cytosol and endosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
