-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOM20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TOM20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16504A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOM20 |
| Target Synonyms | MAS20; MOM19; TOM20; 20 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, MCF7, Mouse brain, Mouse liver, Rat thymus, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE | Uniprot ID | Q15388 |
Uniprot Id
Q15388
Target Species
Human
Target Name
TOMM20
Target Full Name
Mitochondrial import receptor subunit TOM20 homolog
Target Function
Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Target Protein Families
Tom20 family
Target Synonyms
KIAA0016; MAS20; MGC117367; Mitochondrial 20 kDa outer membrane protein; Mitochondrial import receptor subunit TOM20 homolog; MOM19; Outer mitochondrial membrane receptor Tom20; TOM20; TOM20_HUMAN; TOMM20; Translocase of outer mitochondrial membrane 20 homolog (yeast); Translocase of outer mitochondrial membrane 20 homolog type II
Target Background
Enables protein-transporting ATPase activity and unfolded protein binding activity. Involved in protein targeting to mitochondrion. Located in mitochondria-associated endoplasmic reticulum membrane and mitochondrial outer membrane.
Notification