Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOMM22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOMM22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05576A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOMM22 |
| Target Synonyms | 1C9-2; TOM22; MST065; MSTP065; TOMM22 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human TOMM22 (NP_064628.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA | Uniprot ID | Q9NS69 |
Uniprot Id
Q9NS69
Target Species
Human
Target Name
TOMM22
Target Full Name
Mitochondrial import receptor subunit TOM22 homolog
Target Function
Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.
Target Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Target Protein Families
Tom22 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
TOMM22; TOM22; Mitochondrial import receptor subunit TOM22 homolog; hTom22; 1C9-2; Translocase of outer membrane 22 kDa subunit homolog
Target Background
The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
