Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOMM6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human TOMM6 (NP_001127965.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TOMM6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human TOMM6 (NP_001127965.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03850A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOMM6 |
| Target Synonyms | OBTP; TOM6; TOMM6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human TOMM6 (NP_001127965.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGV | Uniprot ID | Q96B49 |
Uniprot Id
Q96B49
Target Species
Human
Target Name
TOMM6
Target Full Name
Mitochondrial import receptor subunit TOM6 homolog
Target Subcellular Location
Mitochondrion outer membrane.
Target Protein Families
Tom6 family
Target Synonyms
Mitochondrial import receptor subunit TOM6 homolog; OBTP; Over expressed breast tumor protein; Overexpressed breast tumor protein; TOM6; TOM6_HUMAN; TOMM6; Translocase of outer membrane 6 kDa subunit homolog; Translocase of outer mitochondrial membrane 6 homolog (yeast)
Target Background
Predicted to be involved in protein transport. Located in mitochondrion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
