-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOP1MT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-550 of human TOP1MT (NP_443195.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TOP1MT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 470-550 of human TOP1MT (NP_443195.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04966A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOP1MT |
| Target Synonyms | TOP1MT | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 470-550 of human TOP1MT (NP_443195.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RATPSTFEKSMQNLQTKIQAKKEQVAEARAELRRARAEHKAQGDGKSRSVLEKKRRLLEKLQEQLAQLSVQATDKEENKQV | Uniprot ID | Q969P6 |
Uniprot Id
Q969P6
Target Species
Human
Target Name
TOP1MT
Target Full Name
DNA topoisomerase I, mitochondrial
Target Function
Releases the supercoiling and torsional tension of DNA introduced during duplication of mitochondrial DNA by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then rotates around the intact phosphodiester bond on the opposing strand, thus removing DNA supercoils. Finally, in the religation step, the DNA 5'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Type IB topoisomerase family
Target Tissue Specificity
Ubiquitous; highest in skeletal muscle, heart, brain and fetal liver.
Target Synonyms
TOP1MT; DNA topoisomerase I; mitochondrial; TOP1mt; EC 5.6.2.1
Target Background
This gene encodes a mitochondrial DNA topoisomerase that plays a role in the modification of DNA topology. The encoded protein is a type IB topoisomerase and catalyzes the transient breaking and rejoining of DNA to relieve tension and DNA supercoiling generated in the mitochondrial genome during replication and transcription. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification