-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOP3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOP3A (XP_011522303.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOP3A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOP3A (XP_011522303.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04220A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOP3A |
| Target Synonyms | TOP3; PEOB5; ZGRF7; MGRISCE2; TOP3A | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TOP3A (XP_011522303.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MILARNYLDVYPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAEHIETIKARMYVGLTPDKRFLPGHLGMGLVE | Uniprot ID | Q13472 |
Uniprot Id
Q13472
Target Species
Human
Target Name
TOP3A
Target Full Name
DNA topoisomerase 3-alpha
Target Function
Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at a target site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand thus removing DNA supercoils. Finally, in the religation step, the DNA 3'-OH attacks the covalent intermediate to expel the active-site tyrosine and restore the DNA phosphodiester backbone. As an essential component of the RMI complex it is involved in chromosome separation and the processing of homologous recombination intermediates to limit DNA crossover formation in cells. Has DNA decatenation activity. It is required for mtDNA decatenation and segregation after completion of replication, in a process that does not require BLM, RMI1 and RMI2.
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Type IA topoisomerase family
Target Tissue Specificity
High expression is found in testis, heart, skeletal muscle and pancreas.
Target Synonyms
DNA topoisomerase 3 alpha; DNA topoisomerase 3-alpha; DNA topoisomerase III alpha; TOP 3; TOP3; TOP3A; TOP3A_HUMAN; topo III-alpha; topoisomerase (DNA) III alpha; topoisomerase (DNA) III; topoisomerase III alpha; ZGRF7; zinc finger; GRF-type containing 7
Target Background
This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus reducing the number of supercoils and altering the topology of DNA. This enzyme forms a complex with BLM which functions in the regulation of recombination in somatic cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification