Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TOR4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TOR4A (Q9NXH8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TOR4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TOR4A (Q9NXH8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse Thymus, using TOR4A Rabbit mAb at 1 : 1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
| Cat.No | ADA-13405A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TOR4A |
| Target Synonyms | C9orf167; TOR4A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Jurkat, K-562, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TOR4A (Q9NXH8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIV | Uniprot ID | Q9NXH8 |
Uniprot Id
Q9NXH8
Target Species
Human
Target Name
TOR4A
Target Full Name
Torsin-4A
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Protein Families
ClpA/ClpB family, Torsin subfamily
Target Synonyms
TOR4A; C9orf167; Torsin-4A; Torsin family 4 member A
Target Background
Predicted to enable ATP binding activity. Predicted to be located in extracellular region and platelet alpha granule lumen. Predicted to be active in endoplasmic reticulum lumen and nuclear envelope.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
