-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TorsinA/TOR1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 233-332 of human TorsinA/TOR1A (O14656) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TorsinA/TOR1A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 233-332 of human TorsinA/TOR1A (O14656) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13453A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TorsinA/TOR1A |
| Target Synonyms | DQ2; AMC5; DYT1; TorsinA/TOR1A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2, Mouse brain, Mouse liver, Mouse spleen, Rat lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 233-332 of human TorsinA/TOR1A (O14656). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD | Uniprot ID | O14656 |
Uniprot Id
O14656
Target Species
Human
Target Name
TOR1A
Target Full Name
Torsin-1A
Target Function
Protein with chaperone functions important for the control of protein folding, processing, stability and localization as well as for the reduction of misfolded protein aggregates. Involved in the regulation of synaptic vesicle recycling, controls STON2 protein stability in collaboration with the COP9 signalosome complex (CSN). In the nucleus, may link the cytoskeleton with the nuclear envelope, this mechanism seems to be crucial for the control of nuclear polarity, cell movement and, specifically in neurons, nuclear envelope integrity. Participates in the cellular trafficking and may regulate the subcellular location of multipass membrane proteins such as the dopamine transporter SLC6A3, leading to the modulation of dopamine neurotransmission. In the endoplasmic reticulum, plays a role in the quality control of protein folding by increasing clearance of misfolded proteins such as SGCE variants or holding them in an intermediate state for proper refolding. May have a redundant function with TOR1B in non-neural tissues.
Target Involvement
Dystonia 1, torsion, autosomal dominant (DYT1)
Target Subcellular Location
Endoplasmic reticulum lumen. Nucleus membrane; Peripheral membrane protein. Cell projection, growth cone. Cytoplasmic vesicle membrane. Cytoplasmic vesicle, secretory vesicle. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Cytoplasm, cytoskeleton.
Target Protein Families
ClpA/ClpB family, Torsin subfamily
Target Tissue Specificity
Widely expressed. Highest levels in kidney and liver. In the brain, high levels found in the dopaminergic neurons of the substantia nigra pars compacta, as well as in the neocortex, hippocampus and cerebellum. Also highly expressed in the spinal cord.
Target Synonyms
DQ2; Dystonia 1; Dystonia 1 protein; Dystonia 1 torsion; Dyt1; TOR1A; TOR1A_HUMAN; Torsin 1A; Torsin A; Torsin family 1 member A; Torsin family 1, member A (torsin A); Torsin-1A
Target Background
The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1.
Notification