Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TP53I13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TP53I13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04741A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TP53I13 |
| Target Synonyms | DSCP1; TP53I13 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-310 of human TP53I13 (NP_612358.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSWRPPGTEVTSQGPRQPSSSGAKRRRLRAALGPQPTRSALRFPSASPGSLKAKQSMAGIPGRESNAPSVPTVSLLPGAPGGNASSRTEAQVPNGQGSPGGCVCSSQASPAPRAAAPPRAARGPTPRTEEA | Uniprot ID | Q8NBR0 |
Uniprot Id
Q8NBR0
Target Species
Human
Target Name
TP53I13
Target Full Name
Tumor protein p53-inducible protein 13
Target Function
May act as a tumor suppressor. Inhibits tumor cell growth, when overexpressed.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein; Extracellular side. Cytoplasm. Note=Associates with unknown subcellular structures in the cytoplasm.
Target Tissue Specificity
Expressed in heart, placenta, skeletal muscle, testis, brain and lung.
Target Synonyms
TP53I13; DSCP1; Tumor protein p53-inducible protein 13; Damage-stimulated cytoplasmic protein 1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
