-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TP53I3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-332 of human TP53I3 (NP_671713.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TP53I3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 163-332 of human TP53I3 (NP_671713.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02422A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TP53I3 |
| Target Synonyms | PIG3; TP53I3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, HepG2, Mouse liver, Rat kidney, Rat liver, SW480, SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 163-332 of human TP53I3 (NP_671713.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ | Uniprot ID | Q53FA7 |
Uniprot Id
Q53FA7
Target Species
Human
Target Name
TP53I3
Target Full Name
Quinone oxidoreductase PIG3
Target Function
May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent beta-naphthoquinone reductase activity, with a preference for 1,2-beta-naphthoquinone over 1,4-beta-naphthoquinone. Has low NADPH-dependent diamine reductase activity (in vitro).
Target Protein Families
Zinc-containing alcohol dehydrogenase family, Quinone oxidoreductase subfamily
Target Synonyms
p53 induced gene 3 protein ; p53-induced gene 3 protein; Putative quinone oxidoreductase; QORX_HUMAN; quinone oxidoreductase homolog; Quinone oxidoreductase PIG3; TP53I3; Tumor protein p53 inducible protein 3; Tumor protein p53-inducible protein 3
Target Background
The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell death. It contains a p53 consensus binding site in its promoter region and a downstream pentanucleotide microsatellite sequence. P53 has been shown to transcriptionally activate this gene by interacting with the downstream pentanucleotide microsatellite sequence. The microsatellite is polymorphic, with a varying number of pentanucleotide repeats directly correlated with the extent of transcriptional activation by p53. It has been suggested that the microsatellite polymorphism may be associated with differential susceptibility to cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification