-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TP73 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human TP73 (NP_005418.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TP73 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human TP73 (NP_005418.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04271A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TP73 |
| Target Synonyms | P73; CILD47; TP73 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MDA-MB231 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 487-636 of human TP73 (NP_005418.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRGGPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH | Uniprot ID | O15350 |
Uniprot Id
O15350
Target Species
Human
Target Name
TP73
Target Full Name
Tumor protein p73
Target Function
Participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. May be a tumor suppressor protein.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Accumulates in the nucleus in response to DNA damage.
Target Protein Families
P53 family
Target Tissue Specificity
Expressed in striatal neurons of patients with Huntington disease (at protein level). Brain, kidney, placenta, colon, heart, liver, spleen, skeletal muscle, prostate, thymus and pancreas. Highly expressed in fetal tissue.
Target Synonyms
p53 like transcription factor; p53 related protein; p53-like transcription factor; p53-related protein; p73; P73_HUMAN; TP73; Tumor protein p73
Target Background
This gene encodes a member of the p53 family of transcription factors involved in cellular responses to stress and development. It maps to a region on chromosome 1p36 that is frequently deleted in neuroblastoma and other tumors, and thought to contain multiple tumor suppressor genes. The demonstration that this gene is monoallelically expressed (likely from the maternal allele), supports the notion that it is a candidate gene for neuroblastoma. Many transcript variants resulting from alternative splicing and/or use of alternate promoters have been found for this gene, but the biological validity and the full-length nature of some variants have not been determined.
Notification