Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPD52L3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human TPD52L3 (NP_001001875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TPD52L3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human TPD52L3 (NP_001001875.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04980A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPD52L3 |
| Target Synonyms | D55; hD55; TPD55; NYDSP25; TPD52L3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-132 of human TPD52L3 (NP_001001875.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPHARTETSVGTYESHSTSELEDLTEPEQRELKTKLTKLEAEIVTLRHVLAAKERRCGELKRKLGLTALVGLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRSFEGNPKGEGSRI | Uniprot ID | Q96J77 |
Uniprot Id
Q96J77
Target Species
Human
Target Name
TPD52L3
Target Full Name
Tumor protein D55
Target Synonyms
TPD52L3; Tumor protein D55; hD55; Testis development protein NYD-SP25; Tumor protein D52-like 3
Target Background
This gene encodes a member of the tumor protein D52-like family of proteins. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. The encoded protein may play a role in spermatogenesis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
