Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TPH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11910A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPH1 |
| Target Synonyms | TPRH; TRPH; TPH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F transfected with TPH1, Mouse brain, Rat colon | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 345-444 of human TPH1 (NP_004170.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI | Uniprot ID | P17752 |
Uniprot Id
P17752
Target Species
Human
Target Name
TPH1
Target Full Name
Tryptophan 5-hydroxylase 1
Target Function
Oxidizes L-tryptophan to 5-hydroxy-l-tryptophan in the rate-determining step of serotonin biosynthesis.
Target Protein Families
Biopterin-dependent aromatic amino acid hydroxylase family
Target Tissue Specificity
[Isoform 2]: Seems to be less widely expressed than isoform 1.
Target Synonyms
Indoleacetic acid 5 hydroxylase; L tryptophan hydroxylase; MGC119994; TPH 1; TPH; TPH1; TPH1_HUMAN; TPRH; TRPH; Tryptophan 5 hydroxylase 1; Tryptophan 5 monooxygenase 1; Tryptophan 5 monooxygenase; Tryptophan 5-hydroxylase 1; Tryptophan 5-monooxygenase 1; Tryptophan hydroxylase 1
Target Background
This gene encodes a member of the aromatic amino acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene have been associated with an elevated risk for a variety of diseases and disorders, including schizophrenia, somatic anxiety, anger-related traits, bipolar disorder, suicidal behavior, addictions, and others.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
