Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPPP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human TPPP3 (NP_057048.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TPPP3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human TPPP3 (NP_057048.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09428A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPPP3 |
| Target Synonyms | p20; CGI-38; TPPP/p20; p25gamma; TPPP3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, HT-29, Mouse spinal cord, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human TPPP3 (NP_057048.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK | Uniprot ID | Q9BW30 |
Uniprot Id
Q9BW30
Target Species
Human
Target Name
TPPP3
Target Full Name
Tubulin polymerization-promoting protein family member 3
Target Function
Regulator of microtubule dynamic that has microtubule bundling activity. Required for embryo implantation; possibly by regulating beta-catenin. Also required for decidualization via regulation of beta-catenin.
Target Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton.
Target Protein Families
TPPP family
Target Tissue Specificity
Expressed in endometrium during the mid-secretory phase (LH + 7) (at protein level).
Target Synonyms
CGI-38; p20; p25gamma; TPPP/p20; Tppp3; TPPP3_HUMAN; Tubulin polymerization-promoting protein family member 3
Target Background
Enables tubulin binding activity. Involved in decidualization and microtubule bundle formation. Colocalizes with microtubule bundle and perinuclear region of cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
