Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPRG1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TPRG1L (NP_877429.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TPRG1L was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TPRG1L (NP_877429.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11357A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPRG1L |
| Target Synonyms | TPRGL; mover; FAM79A; SVAP30; h-mover; TPRG1L | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TPRG1L (NP_877429.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI | Uniprot ID | Q5T0D9 |
Uniprot Id
Q5T0D9
Target Species
Human
Target Name
TPRG1L
Target Full Name
Tumor protein p63-regulated gene 1-like protein
Target Function
Presynaptic protein involved in the synaptic transmission tuning. Regulates synaptic release probability by decreasing the calcium sensitivity of release.
Target Subcellular Location
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Peripheral membrane protein. Cell junction, synapse, presynaptic active zone.
Target Protein Families
TPRG1 family
Target Synonyms
FAM79A; Mossy fiber terminal-associated vertebrate-specific presynaptic protein; MOVER; Protein FAM79A; TPRG1L; TPRGL_HUMAN; Tumor protein p63-regulated gene 1-like protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
