Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPST2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human TPST2 (NP_003586.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TPST2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human TPST2 (NP_003586.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02722A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPST2 |
| Target Synonyms | TPST-2; TANGO13B; TPST2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-2 OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 280-370 of human TPST2 (NP_003586.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNST | Uniprot ID | O60704 |
Uniprot Id
O60704
Target Species
Human
Target Name
TPST2
Target Full Name
Protein-tyrosine sulfotransferase 2
Target Function
Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides, using 3'-phosphoadenylyl sulfate (PAPS) as cosubstrate.
Target Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.
Target Protein Families
Protein sulfotransferase family
Target Tissue Specificity
Widely expressed.
Target Research Area
Cardiovascular
Target Synonyms
EC 2.8.2.20; Protein tyrosine sulfotransferase 2; Protein-tyrosine sulfotransferase 2; TANGO13B; TPST-2; Tpst2; TPST2_HUMAN; Transport and golgi organization 13 homolog B; Tyrosylprotein phosphotransferase 2; Tyrosylprotein sulfotransferase 2
Target Background
The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
