-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAF6BP/TAX1BP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 690-789 of human TRAF6BP/TAX1BP1 (Q86VP1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRAF6BP/TAX1BP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 690-789 of human TRAF6BP/TAX1BP1 (Q86VP1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14337A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAF6BP/TAX1BP1 |
| Target Synonyms | T6BP; TXBP151; CALCOCO3; TRAF6BP/TAX1BP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Mouse testis, U-251MG, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 690-789 of human TRAF6BP/TAX1BP1 (Q86VP1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD | Uniprot ID | Q86VP1 |
Uniprot Id
Q86VP1
Target Species
Human
Target Name
TAX1BP1
Target Full Name
Tax1-binding protein 1
Target Function
Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade.
Target Tissue Specificity
Expressed in all tissues tested.
Target Synonyms
1200003J11Rik; 1700069J21Rik; Aa1076; AA930106; CALCOCO 3; CALCOCO3; D6Ertd404e; D6Ertd772e; Human T cell leukemia virus type 1-binding protein; Liver regeneration-related protein LRRG004; MGC94031; PRO0105; T6BP; Tax1 (human T cell leukemia virus type I) binding protein; Tax1 (human T cell leukemia virus type I) binding protein 1; Tax1 binding protein 1; Tax1 binding protein; Tax1-binding protein 1; Tax1-binding protein 1 homolog; TAX1BP1; TAX1BP1 protein; tax1bp1b; TAXB1_HUMAN; TRAF 6 binding protein; TRAF6 binding protein; TRAF6 binding protein T6BP; TRAF6-binding protein; TRAF6-interacting protein; TXBP 151; TXBP151; wu:fc20c12; wu:fc56e11; zgc:73219; zgc:77129
Target Background
This gene encodes a HTLV-1 tax1 binding protein. The encoded protein interacts with TNFAIP3, and inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degradation of this protein by caspase-3-like family proteins is associated with apoptosis induced by TNF. This protein may also have a role in the inhibition of inflammatory signaling pathways. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification