-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Transferrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Transferrin (P02787) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Transferrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human Transferrin (P02787) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16768A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Transferrin |
| Target Synonyms | TFQTL1; PRO1557; PRO2086; HEL-S-71p; Transferrin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | human serum | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Transferrin (P02787). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIP | Uniprot ID | P02787 |
Uniprot Id
P02787
Target Species
Human
Target Name
TF
Target Full Name
Serotransferrin
Target Function
Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. It is responsible for the transport of iron from sites of absorption and heme degradation to those of storage and utilization. Serum transferrin may also have a further role in stimulating cell proliferation.; (Microbial infection) Serves as an iron source for Neisseria species, which capture the protein and extract its iron for their own use.
Target Involvement
Atransferrinemia (ATRAF)
Target Subcellular Location
Secreted.
Target Protein Families
Transferrin family
Target Tissue Specificity
Expressed by the liver and secreted in plasma.
Target Synonyms
TFQTL1; PRO1557; PRO2086; HEL-S-71p; Transferrin
Target Background
This gene encodes a glycoprotein with an approximate molecular weight of 76.5 kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum.
Notification