Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAPPC6B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TRAPPC6B (NP_803235.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TRAPPC6B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TRAPPC6B (NP_803235.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11378A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAPPC6B |
| Target Synonyms | TPC6; NEDMEBA; TRAPPC6B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Rat lung, Rat testis | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human TRAPPC6B (NP_803235.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIMKFICKDFWTTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL | Uniprot ID | Q86SZ2 |
Uniprot Id
Q86SZ2
Target Species
Human
Target Name
TRAPPC6B
Target Full Name
Trafficking protein particle complex subunit 6B
Target Function
Component of a transport protein particle (TRAPP) complex that may function in specific stages of inter-organelle traffic. Specifically involved in the early development of neural circuitry, likely by controlling the frequency and amplitude of intracellular calcium transients implicated in the regulation of neuron differentiation and survival (Probable).
Target Subcellular Location
Golgi apparatus, cis-Golgi network. Endoplasmic reticulum.
Target Protein Families
TRAPP small subunits family, BET3 subfamily
Target Tissue Specificity
Both isoforms are expressed ubiquitously (at transcript level), isoform 1 being the most predominant. Expressed in the fetal brain and different regions of the adult brain and spinal cord.
Target Synonyms
TRAPPC6B; Trafficking protein particle complex subunit 6B; TRAPP complex subunit 6B
Target Background
TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport (Kummel et al., 2005 [PubMed 16025134]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
