-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human TRIAP1 (NP_057483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIAP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human TRIAP1 (NP_057483.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02576A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIAP1 |
| Target Synonyms | WF-1; MDM35; P53CSV; HSPC132; TRIAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293F, Mouse placenta | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-76 of human TRIAP1 (NP_057483.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS | Uniprot ID | O43715 |
Uniprot Id
O43715
Target Species
Human
Target Name
TRIAP1
Target Full Name
TP53-regulated inhibitor of apoptosis 1
Target Function
Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis.
Target Subcellular Location
Mitochondrion. Mitochondrion intermembrane space.
Target Protein Families
TRIAP1/MDM35 family
Target Research Area
Cell Biology
Target Synonyms
p53-inducible cell-survival factor; p53CSV; Protein 15E1.1; TP53-regulated inhibitor of apoptosis 1; TRIA1_HUMAN; Triap1; WF 1; WF1
Target Background
Enables p53 binding activity. Contributes to phosphatidic acid transfer activity. Involved in several processes, including DNA damage response, signal transduction by p53 class mediator; negative regulation of apoptotic process; and positive regulation of phospholipid transport. Located in mitochondrial intermembrane space and nucleoplasm. Part of protein-containing complex.
Notification