-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIF/TICAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human TRIF/TICAM1 (NP_891549.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIF/TICAM1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human TRIF/TICAM1 (NP_891549.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06157A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIF/TICAM1 |
| Target Synonyms | TRIF; IIAE6; MyD88-3; PRVTIRB; TICAM-1; TRIF/TICAM1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Mouse spleen, Raji, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human TRIF/TICAM1 (NP_891549.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEARNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSP | Uniprot ID | Q8IUC6 |
Uniprot Id
Q8IUC6
Target Species
Human
Target Name
TICAM1
Target Full Name
TIR domain-containing adapter molecule 1
Target Function
Involved in innate immunity against invading pathogens. Adapter used by TLR3, TLR4 (through TICAM2) and TLR5 to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TRIF recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively. Phosphorylation by TBK1 on the pLxIS motif leads to recruitment and subsequent activation of the transcription factor IRF3 to induce expression of type I interferon and exert a potent immunity against invading pathogens. Component of a multi-helicase-TICAM1 complex that acts as a cytoplasmic sensor of viral double-stranded RNA (dsRNA) and plays a role in the activation of a cascade of antiviral responses including the induction of proinflammatory cytokines.
Target Involvement
Herpes simplex encephalitis 4 (HSE4)
Target Subcellular Location
Cytoplasmic vesicle, autophagosome. Cytoplasm, cytosol. Mitochondrion.
Target Tissue Specificity
Ubiquitously expressed but with higher levels in liver.
Target Synonyms
TICAM1; PRVTIRB; TRIF; TIR domain-containing adapter molecule 1; TICAM-1; Proline-rich, vinculin and TIR domain-containing protein B; Putative NF-kappa-B-activating protein 502H; Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; MyD88-3; TIR domain-containing adapter protein inducing IFN-beta
Target Background
This gene encodes an adaptor protein containing a Toll/interleukin-1 receptor (TIR) homology domain, which is an intracellular signaling domain that mediates protein-protein interactions between the Toll-like receptors (TLRs) and signal-transduction components. This protein is involved in native immunity against invading pathogens. It specifically interacts with toll-like receptor 3, but not with other TLRs, and this association mediates dsRNA induction of interferon-beta through activation of nuclear factor kappa-B, during an antiviral immune response. Mutations in this gene are associated with encephalopathy, acute, infection-induced.
Notification