-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM25 (Q14258) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM25 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM25 (Q14258) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17179A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM25 |
| Target Synonyms | EFP; Z147; RNF147; ZNF147; 25 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TRIM25 (Q14258). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPNAQVACDHCLKEAAVKTCLVCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHICLVEHKTCSPASLSQASADLEA | Uniprot ID | Q14258 |
Uniprot Id
Q14258
Target Species
Human
Target Name
TRIM25
Target Full Name
E3 ubiquitin/ISG15 ligase TRIM25
Target Function
Functions as a ubiquitin E3 ligase and as an ISG15 E3 ligase. Involved in innate immune defense against viruses by mediating ubiquitination of DDX58 and IFIH1. Mediates 'Lys-63'-linked polyubiquitination of the DDX58 N-terminal CARD-like region and may play a role in signal transduction that leads to the production of interferons in response to viral infection. Mediates 'Lys-63'-linked polyubiquitination of IFIH1. Promotes ISGylation of 14-3-3 sigma (SFN), an adapter protein implicated in the regulation of a large spectrum signaling pathway. Mediates estrogen action in various target organs. Mediates the ubiquitination and subsequent proteasomal degradation of ZFHX3. Plays a role in promoting the restart of stalled replication forks via interaction with the KHDC3L-OOEP scaffold and subsequent ubiquitination of BLM, resulting in the recruitment and retainment of BLM at DNA replication forks.
Target Subcellular Location
Cytoplasm. Cytoplasm, Stress granule. Nucleus.
Target Tissue Specificity
Expressed in breast tumors (at protein level). Ubiquitous.
Target Synonyms
E3 ubiquitin/ISG15 ligase TRIM25; EFP; Estrogen responsive finger protein; Estrogen-responsive finger protein; RING finger protein 147; RNF 147; RNF147; TRI25; TRI25_HUMAN; TRIM 25; Trim25; Tripartite motif containing 25; Tripartite motif containing protein 25; Tripartite motif protein TRIM25; Tripartite motif-containing protein 25; Tripartite motifcontaining25; Ubiquitin/ISG15-conjugating enzyme TRIM25; Z147; Zinc finger protein 147 (estrogen responsive finger protein); Zinc finger protein 147; Zinc finger protein-147; ZNF 147; ZNF147
Target Background
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein is an RNA binding protein, functions as a ubiquitin E3 ligase and is involved in multiple cellular processes, including regulation of antiviral innate immunity.
Notification