Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-465 of human TRIM38 (NP_006346.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 266-465 of human TRIM38 (NP_006346.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04315A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM38 |
| Target Synonyms | RNF15; RORET; TRIM38 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 266-465 of human TRIM38 (NP_006346.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDTAHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWDLGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEAGVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD | Uniprot ID | O00635 |
Uniprot Id
O00635
Target Species
Human
Target Name
TRIM38
Target Full Name
E3 ubiquitin-protein ligase TRIM38
Target Function
E3 ubiquitin-protein ligase. Mediates 'Lys-48'-linked polyubiquitination and proteasomal degradation of the critical TLR adapter TICAM1, inhibiting TLR3-mediated type I interferon signaling.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
TRIM38; RNF15; RORET; E3 ubiquitin-protein ligase TRIM38; EC 2.3.2.27; RING finger protein 15; RING-type E3 ubiquitin transferase TRIM38; Tripartite motif-containing protein 38; Zinc finger protein RoRet
Target Background
This gene encodes a member of the tripartite motif (TRIM) family. The encoded protein contains a RING-type zinc finger, B box-type zinc finger and SPRY domain. The function of this protein has not been identified. A pseudogene of this gene is located on the long arm of chromosome 4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
