-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM39 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human TRIM39 (NP_067076.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM39 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human TRIM39 (NP_067076.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00835A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM39 |
| Target Synonyms | TFP; RNF23; TRIM39B; TRIM39 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, K-562, LO2, MCF7, SW480 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human TRIM39 (NP_067076.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLH | Uniprot ID | Q9HCM9 |
Uniprot Id
Q9HCM9
Target Species
Human
Target Name
TRIM39
Target Full Name
E3 ubiquitin-protein ligase TRIM39
Target Function
E3 ubiquitin-protein ligase. May facilitate apoptosis by inhibiting APC/C-Cdh1-mediated poly-ubiquitination and subsequent proteasome-mediated degradation of the pro-apoptotic protein MOAP1. Regulates the G1/S transition of the cell cycle and DNA damage-induced G2 arrest by stabilizing CDKN1A/p21. Positively regulates CDKN1A/p21 stability by competing with DTL for CDKN1A/p21 binding, therefore disrupting DCX(DTL) E3 ubiquitin ligase complex-mediated CDKN1A/p21 ubiquitination and degradation.; Regulates the G1/S transition of the cell cycle and DNA damage-induced G2 arrest by stabilizing CDKN1A/p21. Positively regulates CDKN1A/p21 stability by competing with DTL for CDKN1A/p21 binding, therefore disrupting DCX(DTL) E3 ubiquitin ligase complex-mediated CDKN1A/p21 ubiquitination and degradation. Negatively regulates the canonical NF-kappa-B signaling pathway via stabilization of CACTIN in an ubiquitination-independent manner.
Target Subcellular Location
[Isoform 1]: Cytoplasm, cytosol. Mitochondrion. Nucleus.; [Isoform 2]: Nucleus.
Target Protein Families
TRIM/RBCC family
Target Tissue Specificity
Ubiquitous; highly expressed in brain, heart, kidney, liver, skeletal muscle, spleen and testis.
Target Synonyms
HGNC:10065; MGC32984; RING finger protein 23; RNF23; Testis abundant finger protein; Testis-abundant finger protein; TFP; TFP RING FINGER PROTEIN 23; TRI39_HUMAN; Trim39; TRIM39B; Tripartite motif containing 39; Tripartite motif-containing protein 39
Target Background
The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6. Alternate splicing results in two transcript variants encoding different isoforms.
Notification