Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 205-344 of human TRIM44 (NP_060053.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 205-344 of human TRIM44 (NP_060053.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01125A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM44 |
| Target Synonyms | AN3; MC7; DIPB; HSA249128; TRIM44 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 205-344 of human TRIM44 (NP_060053.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT | Uniprot ID | Q96DX7 |
Uniprot Id
Q96DX7
Target Species
Human
Target Name
TRIM44
Target Full Name
Tripartite motif-containing protein 44
Target Function
May play a role in the process of differentiation and maturation of neuronal cells. May regulate the activity of TRIM17. Is a negative regulator of PAX6 expression.
Target Involvement
Aniridia 3 (AN3)
Target Tissue Specificity
Highly expressed in testis.
Target Synonyms
AN3; DIPB; HSA249128; MC7 ; MGC3490; Protein DIPB; TRI44_HUMAN; TRIM44; Tripartite motif containing 44; Tripartite motif containing protein 44; Tripartite motif-containing protein 44
Target Background
This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
