Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM54 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human TRIM54 (NP_912730.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM54 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human TRIM54 (NP_912730.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03437A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM54 |
| Target Synonyms | MURF; RNF30; muRF3; MURF-3; TRIM54 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, A-549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 179-358 of human TRIM54 (NP_912730.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AMLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFESLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELAGRPEPGYESMEQFTVRVEHVAEMLRTIDFQPGASGEEEEVAPDGEEGSAGPEEERPDGP | Uniprot ID | Q9BYV2 |
Uniprot Id
Q9BYV2
Target Species
Human
Target Name
TRIM54
Target Full Name
Tripartite motif-containing protein 54
Target Function
May bind and stabilize microtubules during myotubes formation.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, myofibril, sarcomere, Z line.
Target Tissue Specificity
Specifically expressed in heart and skeletal muscle.
Target Synonyms
MURF 3; MuRF; MURF-3; MuRF3; Muscle specific RING finger protein 3; Muscle specific RING finger protein; Muscle specific RING finger protein homolog; Muscle-specific RING finger protein 3; Muscle-specific RING finger protein; RING finger protein 30; RNF30; TRI54_HUMAN; TRIM 54; Trim54; Tripartite motif containing 54 ; Tripartite motif containing protein 54; Tripartite motif-containing protein 54
Target Background
The protein encoded by this gene contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
