Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRIM65 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-490 of human TRIM65 (NP_775818.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRIM65 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 380-490 of human TRIM65 (NP_775818.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Rat liver, using TRIM65 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
| Cat.No | ADA-08832A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRIM65 |
| Target Synonyms | 4732463G12Rik; TRIM65 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 380-490 of human TRIM65 (NP_775818.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGPCSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHALFNQPLTPVFW | Uniprot ID | Q6PJ69 |
Uniprot Id
Q6PJ69
Target Species
Human
Target Name
TRIM65
Target Full Name
E3 ubiquitin-protein ligase TRIM65
Target Synonyms
TRIM65; Tripartite motif-containing protein 65
Target Background
Predicted to enable zinc ion binding activity. Involved in positive regulation of autophagy. Located in cytosol and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
