Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TriMethyl-Histone H3-K36 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ChIP-seq, ELISA, DB.
The antibody against TriMethyl-Histone H3-K36 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human histone H3 (NP_003520.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ChIP-seq, ELISA, DB.
Western blot analysis of various lysates, using TriMethyl-Histone H3-K36 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-12910A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TriMethyl-Histone H3-K36 |
| Target Synonyms | H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3; TriMethyl-Histone H3-K36 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C2C12, MCF7, PC-12 | Application | ELISA, WB, ChIP, ChIP-seq, DB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H3 (NP_003520.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY | Uniprot ID | Q16695, P68431 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
