-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TROY/TNFRSF19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TROY/TNFRSF19 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14376A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TROY/TNFRSF19 |
| Target Synonyms | TAJ; TROY; TRADE; TAJ-alpha; TROY/TNFRSF19 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 22Rv1, Mouse brain, Mouse lung, Mouse spleen, Raji, Rat lung, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human TROY/TNFRSF19 (Q9NS68). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGDPPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEK | Uniprot ID | Q9NS68 |
Uniprot Id
Q9NS68
Target Species
Human
Target Name
TNFRSF19
Target Full Name
Tumor necrosis factor receptor superfamily member 19
Target Function
Can mediate activation of JNK and NF-kappa-B. May promote caspase-independent cell death.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Highly expressed in prostate. Detected at lower levels in thymus, spleen, testis, uterus, small intestine, colon and peripheral blood leukocytes.
Target Synonyms
AL023044; AW123854; TAJ alpha; TAJ; TAJ-alpha; TNFRSF19; TNFRSF19 tumor necrosis factor receptor superfamily, member 19; TNR19_HUMAN; Toxicity and JNK inducer; TRADE; TROY; Tumor necrosis factor receptor superfamily member 19; UNQ1888/PRO4333
Target Background
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is highly expressed during embryonic development. It has been shown to interact with TRAF family members, and to activate JNK signaling pathway when overexpressed in cells. This receptor is capable of inducing apoptosis by a caspase-independent mechanism, and it is thought to play an essential role in embryonic development. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Notification