-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TRPA1 (NP_015628.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TRPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TRPA1 (NP_015628.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10884A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPA1 |
| Target Synonyms | FEPS; p120; FEPS1; ANKTM1; TRPA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human TRPA1 (NP_015628.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQ | Uniprot ID | O75762 |
Uniprot Id
O75762
Target Species
Human
Target Name
TRPA1
Target Full Name
Transient receptor potential cation channel subfamily A member 1
Target Function
Receptor-activated non-selective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function. Shows 8-fold preference for divalent over monovalent cations. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of irritants, such as allylthiocyanate (AITC) from mustard oil or wasabi, cinnamaldehyde, diallyl disulfide (DADS) from garlic, and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as an ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana. Is activated by a large variety of structurally unrelated electrophilic and non-electrophilic chemical compounds. Electrophilic ligands activate TRPA1 by interacting with critical N-terminal Cys residues in a covalent manner, whereas mechanisms of non-electrophilic ligands are not well determined. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system.
Target Involvement
Episodic pain syndrome, familial, 1 (FEPS1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Transient receptor (TC 1.A.4) family
Target Tissue Specificity
Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells.
Target Synonyms
ANKTM 1; ANKTM1; Ankyrin-like with transmembrane domains protein 1; Transformation sensitive protein p120; Transformation-sensitive protein p120; Transient receptor potential cation channel subfamily A member 1; TRPA 1; Trpa1; TRPA1_HUMAN
Target Background
The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control.
Notification