-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPC7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPC7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07069A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPC7 |
| Target Synonyms | TRP7; TRPC7 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Mouse lung, SH-SY5Y, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY | Uniprot ID | Q9HCX4 |
Uniprot Id
Q9HCX4
Target Species
Human
Target Name
TRPC7
Target Full Name
Short transient receptor potential channel 7
Target Function
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG). May also be activated by intracellular calcium store depletion.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Nucleus envelope.
Target Protein Families
Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC7 sub-subfamily
Target Synonyms
Capacitative calcium channel TRPC7 ; cation channel; subfamily C; member 7; hTRP7; KNP3 ; Likley ortholog of mouse transient receptor potential cation channel subfamily C member 7; mTRP7; Putative capacitative calcium channel; Short transient receptor potential channel 7; Transient receptor potential cation channel subfamily C member 7; transient receptor potential-related channel 7; a novel putative Ca2+ channel protein ; Transient receptor protein 7; TRP 7; TRP-7; TRP7 protein; TRPC 7; TrpC7; Trpc7 transient receptor potential cation channel; subfamily C; member 7; TRPC7_HUMAN; TRPM2 ; Trrp8
Target Background
Predicted to enable inositol 1, 4, 5 trisphosphate binding activity and store-operated calcium channel activity. Predicted to be involved in metal ion transport; regulation of cytosolic calcium ion concentration; and single fertilization. Predicted to act upstream of or within calcium ion transport. Predicted to be located in plasma membrane. Predicted to be part of cation channel complex. Predicted to be integral component of plasma membrane.
Notification