Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRPV2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 655-764 of human TRPV2 (NP_057197.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRPV2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 655-764 of human TRPV2 (NP_057197.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02331A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRPV2 |
| Target Synonyms | VRL; VRL1; VRL-1; TRPV2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 22Rv1, A375, BxPC-3, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 655-764 of human TRPV2 (NP_057197.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DSWSIWKLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPTLCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN | Uniprot ID | Q9Y5S1 |
Uniprot Id
Q9Y5S1
Target Species
Human
Target Name
TRPV2
Target Full Name
Transient receptor potential cation channel subfamily V member 2
Target Function
Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by IGF-I, PDGF and neuropeptide head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Melanosome.
Target Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV2 sub-subfamily
Target Synonyms
TRPV2; VRL; Transient receptor potential cation channel subfamily V member 2; TrpV2; Osm-9-like TRP channel 2; OTRPC2; Vanilloid receptor-like protein 1; VRL-1
Target Background
This gene encodes an ion channel that is activated by high temperatures above 52 degrees Celsius. The protein may be involved in transduction of high-temperature heat responses in sensory ganglia. It is thought that in other tissues the channel may be activated by stimuli other than heat.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
