-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1160-1255 of human TSC2 (NP_000539.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TSC2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1160-1255 of human TSC2 (NP_000539.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11506A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSC2 |
| Target Synonyms | LAM; TSC4; PPP1R160; TSC2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1160-1255 of human TSC2 (NP_000539.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSV | Uniprot ID | P49815 |
Uniprot Id
P49815
Target Species
Human
Target Name
TSC2
Target Full Name
Tuberin
Target Function
In complex with TSC1, this tumor suppressor inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Acts as a GTPase-activating protein (GAP) for the small GTPase RHEB, a direct activator of the protein kinase activity of mTORC1. May also play a role in microtubule-mediated protein transport. Also stimulates the intrinsic GTPase activity of the Ras-related proteins RAP1A and RAB5.
Target Involvement
Tuberous sclerosis 2 (TSC2); Lymphangioleiomyomatosis (LAM); Focal cortical dysplasia 2 (FCORD2)
Target Subcellular Location
Cytoplasm. Membrane; Peripheral membrane protein. Note=At steady state found in association with membranes.
Target Tissue Specificity
Liver, brain, heart, lymphocytes, fibroblasts, biliary epithelium, pancreas, skeletal muscle, kidney, lung and placenta.
Target Synonyms
FLJ43106; LAM; OTTHUMP00000158940; OTTHUMP00000198394; OTTHUMP00000198395; PPP1R160; Protein phosphatase 1; regulatory subunit 160; TSC complex subunit 2; tsc2; TSC2_HUMAN; TSC4; TSC4 gene; formerly; TSC4; formerly; Tuberin; Tuberous sclerosis 2; Tuberous sclerosis 2 protein; Tuberous sclerosis 2 protein homolog
Target Background
This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.
Notification