-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSG101/VPS23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TSG101/VPS23 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12951A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSG101/VPS23 |
| Target Synonyms | TSG10; VPS23; TSG101/VPS23 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 291-390 of human TSG101/VPS23 (NP_006283.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY | Uniprot ID | Q99816 |
Uniprot Id
Q99816
Target Species
Human
Target Name
TSG101
Target Full Name
Tumor susceptibility gene 101 protein
Target Function
Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Binds to ubiquitinated cargo proteins and is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies (MVBs). Mediates the association between the ESCRT-0 and ESCRT-I complex. Required for completion of cytokinesis; the function requires CEP55. May be involved in cell growth and differentiation. Acts as a negative growth regulator. Involved in the budding of many viruses through an interaction with viral proteins that contain a late-budding motif P-[ST]-A-P. This interaction is essential for viral particle budding of numerous retroviruses. Required for the exosomal release of SDCBP, CD63 and syndecan. It may also play a role in the extracellular release of microvesicles that differ from the exosomes.
Target Subcellular Location
Cytoplasm. Early endosome membrane; Peripheral membrane protein; Cytoplasmic side. Late endosome membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Midbody, Midbody ring. Nucleus.
Target Protein Families
Ubiquitin-conjugating enzyme family, UEV subfamily
Target Tissue Specificity
Heart, brain, placenta, lung, liver, skeletal, kidney and pancreas.
Target Research Area
Others
Target Synonyms
ESCRT I complex subunit TSG101; ESCRT-I complex subunit TSG101; TS101_HUMAN; TSG 10; TSG 101; TSG10; Tsg101; Tumor susceptibility 101; Tumor susceptibility gene 10; Tumor susceptibility gene 101; Tumor susceptibility gene 101 protein; Tumor susceptibility protein; Tumor susceptibility protein isoform 3; VPS 23; VPS23
Target Background
The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. The protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Notification