-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TSN (NP_004613.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TSN was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TSN (NP_004613.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07337A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSN |
| Target Synonyms | C3PO; RCHF1; TBRBP; TRSLN; BCLF-1; REHF-1; TSN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, Mouse brain, Mouse spleen, Rat spleen, Rat thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TSN (NP_004613.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFQDIPKRCLKAREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASE | Uniprot ID | Q15631 |
Uniprot Id
Q15631
Target Species
Human
Target Name
TSN
Target Full Name
Translin
Target Function
DNA-binding protein that specifically recognizes consensus sequences at the breakpoint junctions in chromosomal translocations, mostly involving immunoglobulin (Ig)/T-cell receptor gene segments. Seems to recognize single-stranded DNA ends generated by staggered breaks occurring at recombination hot spots.; Exhibits both single-stranded and double-stranded endoribonuclease activity. May act as an activator of RNA-induced silencing complex (RISC) by facilitating endonucleolytic cleavage of the siRNA passenger strand.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Translin family
Target Synonyms
BCLF 1; BCLF1; Component 3 of promoter of RISC; RCHF1; recombination hotspot associated factor; recombination hotspot binding protein; rehf 1; REHF1; TBRBP; Translin; TRSLN; TSN; TSN_HUMAN
Target Background
This gene encodes a DNA-binding protein which specifically recognizes conserved target sequences at the breakpoint junction of chromosomal translocations. Translin polypeptides form a multimeric structure that is responsible for its DNA-binding activity. Recombination-associated motifs and translin-binding sites are present at recombination hotspots and may serve as indicators of breakpoints in genes which are fused by translocations. These binding activities may play a crucial role in chromosomal translocation in lymphoid neoplasms. This protein encoded by this gene, when complexed with translin-associated protein X, also forms a Mg ion-dependent endoribonuclease that promotes RNA-induced silencing complex (RISC) activation. Alternative splicing results in multiple transcript variants.
Notification