Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human TSPAN15 (NP_036471.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSPAN15 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human TSPAN15 (NP_036471.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05668A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN15 |
| Target Synonyms | NET7; NET-7; TM4SF15; 2700063A19Rik; TSPAN15 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-220 of human TSPAN15 (NP_036471.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVVALTFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCT | Uniprot ID | O95858 |
Uniprot Id
O95858
Target Species
Human
Target Name
TSPAN15
Target Full Name
Tetraspanin-15
Target Function
Regulates maturation and trafficking of the transmembrane metalloprotease ADAM10. Promotes ADAM10-mediated cleavage of CDH2. Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Late endosome membrane.
Target Protein Families
Tetraspanin (TM4SF) family
Target Synonyms
TSPAN15; NET7; TM4SF15; UNQ677/PRO1311; Tetraspanin-15; Tspan-15; Tetraspan NET-7; Transmembrane 4 superfamily member 15
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
