Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN33 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human TSPAN33 (NP_848657.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TSPAN33 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human TSPAN33 (NP_848657.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03853A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN33 |
| Target Synonyms | PEN; PEN.; TSPAN-33; TSPAN33 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human TSPAN33 (NP_848657.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY | Uniprot ID | Q86UF1 |
Uniprot Id
Q86UF1
Target Species
Human
Target Name
TSPAN33
Target Full Name
Tetraspanin-33
Target Function
Plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors. Regulates maturation and trafficking of the transmembrane metalloprotease ADAM10. Negatively regulates ligand-induced Notch activity probably by regulating ADAM10 activity. Mediates docking of ADAM10 to zonula adherens by interacting with ADAM10 and, in a PDZD11-dependent manner, with the zonula adherens protein PLEKHA7.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, adherens junction. Cytoplasm.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
Predominantly expressed in erythroblasts.
Target Synonyms
TSPAN33; PEN; Tetraspanin-33; Tspan-33; Penumbra; hPen; Proerythroblast new membrane
Target Background
Enables enzyme binding activity. Involved in pore complex assembly; protein localization to plasma membrane; and protein maturation. Located in plasma membrane. Part of pore complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
