-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TSPAN7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human TSPAN7 (NP_004606.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TSPAN7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human TSPAN7 (NP_004606.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-03036A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TSPAN7 |
| Target Synonyms | A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; XLID58; TALLA-1; TM4SF2b; DXS1692E; TSPAN7 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human TSPAN7 (NP_004606.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF | Uniprot ID | P41732 |
Uniprot Id
P41732
Target Species
Human
Target Name
TSPAN7
Target Full Name
Tetraspanin-7
Target Function
May be involved in cell proliferation and cell motility.
Target Involvement
Mental retardation, X-linked 58 (MRX58)
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
Tetraspanin (TM4SF) family
Target Tissue Specificity
Not solely expressed in T-cells. Expressed in acute myelocytic leukemia cells of some patients.
Target Research Area
Immunology
Target Synonyms
A15; CCG B7; CD231; CD231 antigen; Cell surface glycoprotein A15; DXS1692E; Membrane component chromosome X surface marker 1; Membrane component X chromosome surface marker 1; MRX58; MXS1; T cell acute lymphoblastic leukemia associated antigen 1; T-cell acute lymphoblastic leukemia-associated antigen 1; TALLA 1; TALLA; TALLA-1; TALLA1; Tetraspanin 7; Tetraspanin-7; TM4SF2; TM4SF2b; Transmembrane 4 superfamily 2b; Transmembrane 4 superfamily member 2; Transmembrane protein A15; TSN7_HUMAN; Tspan 7; Tspan-7; TSPAN7
Target Background
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.
Notification