-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TTR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 68-147 of human TTR (P02766) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TTR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 68-147 of human TTR (P02766) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13832A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TTR |
| Target Synonyms | CTS; TTN; ATTR; CTS1; PALB; TBPA; HEL111; HsT2651; TTR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Human plasma, Mouse pancreas | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 68-147 of human TTR (P02766). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKE | Uniprot ID | P02766 |
Uniprot Id
P02766
Target Species
Human
Target Name
TTR
Target Full Name
Transthyretin
Target Function
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain.
Target Involvement
Amyloidosis, transthyretin-related (AMYL-TTR); Hyperthyroxinemia, dystransthyretinemic (DTTRH); Carpal tunnel syndrome 1 (CTS1)
Target Subcellular Location
Secreted. Cytoplasm.
Target Protein Families
Transthyretin family
Target Tissue Specificity
Detected in serum and cerebrospinal fluid (at protein level). Highly expressed in choroid plexus epithelial cells. Detected in retina pigment epithelium and liver.
Target Synonyms
Amyloid polyneuropathy; Amyloidosis I; ATTR; Carpal tunnel syndrome 1; CTS; CTS1; Dysprealbuminemic euthyroidal hyperthyroxinemia; Dystransthyretinemic hyperthyroxinemia; Epididymis luminal protein 111; HEL111; HsT2651; PALB; Prealbumin amyloidosis type I; Prealbumin; Prealbumin Thyroxine-binding; Senile systemic amyloidosis; TBPA; Thyroxine binding prealbumin; Transthyretin; TTHY_HUMAN; TTR; TTR protein
Target Background
This gene encodes one of the three prealbumins, which include alpha-1-antitrypsin, transthyretin and orosomucoid. The encoded protein, transthyretin, is a homo-tetrameric carrier protein, which transports thyroid hormones in the plasma and cerebrospinal fluid. It is also involved in the transport of retinol (vitamin A) in the plasma by associating with retinol-binding protein. The protein may also be involved in other intracellular processes including proteolysis, nerve regeneration, autophagy and glucose homeostasis. Mutations in this gene are associated with amyloid deposition, predominantly affecting peripheral nerves or the heart, while a small percentage of the gene mutations are non-amyloidogenic. The mutations are implicated in the etiology of several diseases, including amyloidotic polyneuropathy, euthyroid hyperthyroxinaemia, amyloidotic vitreous opacities, cardiomyopathy, oculoleptomeningeal amyloidosis, meningocerebrovascular amyloidosis and carpal tunnel syndrome.
Notification