Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TUBB8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-444 of human TUBB8 (NP_817124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TUBB8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-444 of human TUBB8 (NP_817124.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00012A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TUBB8 |
| Target Synonyms | OOMD; OOMD2; OZEMA2; bA631M21.2; TUBB8 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, K-562, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-444 of human TUBB8 (NP_817124.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KTAVCDIPPRGLKMSATFIGNNTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDEEYAEEEVA | Uniprot ID | Q3ZCM7 |
Uniprot Id
Q3ZCM7
Target Species
Human
Target Name
TUBB8
Target Full Name
Tubulin beta-8 chain
Target Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB8 has a key role in meiotic spindle assembly and oocyte maturation.
Target Involvement
Oocyte maturation defect 2 (OOMD2)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
Tubulin family
Target Tissue Specificity
Expressed at a high level in oocytes, at different stages of development.
Target Synonyms
bA631M21.2; Class VIII beta tubulin; HSA10p15 beta tubulin 4Q; RP11-631M21.2; TBB8_HUMAN; TUBB8; Tubulin beta 8; Tubulin beta 8 chain; Tubulin beta 8 class VIII; Tubulin beta-8 chain
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
