Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TUBGCP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TUBGCP2 (NP_006650.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TUBGCP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TUBGCP2 (NP_006650.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01383A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TUBGCP2 |
| Target Synonyms | ALP4; GCP2; GCP-2; SPC97; h103p; hGCP2; SPBC97; Spc97p; hSpc97; Grip103; PAMDDFS; TUBGCP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human TUBGCP2 (NP_006650.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSEFRIHHDVNELLSLLRVHGGDGAEVYIDLLQKNRTPYVTTTVSAHSAKVKIAEFSRTPEDFLKKYDELKSKNTRNLDPLVYLLSKLTEDKETLQYLQQNAKERAELAAAAVGSSTTSINVPAAASKISMQELEELRKQLGSVATGSTLQQSLELKRKMLRDKQNKKNSGQHLPIFPAW | Uniprot ID | Q9BSJ2 |
Uniprot Id
Q9BSJ2
Target Species
Human
Target Name
TUBGCP2
Target Full Name
Gamma-tubulin complex component 2
Target Function
Gamma-tubulin complex is necessary for microtubule nucleation at the centrosome. Plays a role in neuronal migration.
Target Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
TUBGCP family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
1700022B05Rik; A disintegrin and metalloprotease domain 8; Adam8; Gamma ring complex protein 103 kDa; Gamma tubulin complex component 2; Gamma tubulin complex protein 2; Gamma-ring complex protein 103 kDa; Gamma-tubulin complex component 2; GCP 2; GCP-2; GCP2; GCP2_HUMAN; h103p; hGCP2; hGrip103; hSpc97; MGC138162; MGC83533; OTTHUMP00000020808; SPBC97; Spc97p; Spindle pole body protein Spc97 homolog; TUBGCP 2; Tubgcp2; Tubulin gamma complex associated protein 2
Target Background
Predicted to enable gamma-tubulin binding activity. Predicted to contribute to microtubule minus-end binding activity. Involved in brain development and neuron migration. Located in centrosome and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
