-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TWIST2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TWIST2 (NP_476527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TWIST2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TWIST2 (NP_476527.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09671A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TWIST2 |
| Target Synonyms | AMS; FFDD3; BBRSAY; DERMO1; SETLSS; bHLHa39; TWIST2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat uterus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TWIST2 (NP_476527.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK | Uniprot ID | Q8WVJ9 |
Uniprot Id
Q8WVJ9
Target Species
Human
Target Name
TWIST2
Target Full Name
Twist-related protein 2
Target Function
Binds to the E-box consensus sequence 5'-CANNTG-3' as a heterodimer and inhibits transcriptional activation by MYOD1, MYOG, MEF2A and MEF2C. Also represses expression of proinflammatory cytokines such as TNFA and IL1B. Involved in postnatal glycogen storage and energy metabolism. Inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors.
Target Involvement
Focal facial dermal dysplasia 3, Setleis type (FFDD3); Ablepharon-macrostomia syndrome (AMS); Barber-Say syndrome (BBRSAY)
Target Subcellular Location
Nucleus. Cytoplasm. Note=Mainly nuclear during embryonic development. Cytoplasmic in adult tissues.
Target Tissue Specificity
In the embryo, highly expressed in chondrogenic cells. In embryonic skin, expressed in the undifferentiated mesenchymal layer beneath the epidermis which later develops into the dermis. Expressed in early myeloid cells but not in lymphoid cells in the liv
Target Synonyms
bHLHa39; Class A basic helix-loop-helix protein 39; Dermis expressed protein 1; Dermis-expressed protein 1; DERMO 1; Dermo-1; DERMO1; MGC117334; Twist 2; Twist homolog 2 (Drosophila); Twist homolog 2; Twist related bHLH protein Dermo1; Twist related protein 2; Twist-related protein 2; Twist2; TWST2_HUMAN
Target Background
The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found.
Notification