-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TYK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1102-1182 of human TYK2 (NP_003322.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TYK2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1102-1182 of human TYK2 (NP_003322.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11874A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TYK2 |
| Target Synonyms | JTK1; IMD35; TYK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Raji | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1102-1182 of human TYK2 (NP_003322.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPS | Uniprot ID | P29597 |
Uniprot Id
P29597
Target Species
Human
Target Name
TYK2
Target Full Name
Non-receptor tyrosine-protein kinase TYK2
Target Function
Non-receptor kinase involved in various processes including cell growth, development, cell migration, innate and adaptive immunity. Plays both structural and catalytic roles in numerous cytokines and interferons signaling. Associates with cytokine and growth factor receptors and activate STAT family members including STAT1, STAT3, STAT4 or STAT6. The heterodimeric cytokine receptor complexes are composed of a TYK2-associated receptor chain (IFNAR1, IL12RB1, IL10RB or IL13RA1) which serves as the signal transducing chain harboring STAT docking sites once phosphorylated by TYK2, and a second receptor chain associated either with JAK1 or JAK2. In turn, recruited STATs are phosphorylated, form homo- and heterodimers, translocate to the nucleus, and regulate cytokine/growth factor responsive genes. Negatively regulates STAT3 activity by promototing phosphorylation at a specific tyrosine that differs from the site used for signaling.
Target Involvement
Immunodeficiency 35 (IMD35)
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, JAK subfamily
Target Tissue Specificity
Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
Target Research Area
Signal Transduction
Target Synonyms
JTK 1; JTK1; Non receptor tyrosine protein kinase 2; Non receptor tyrosine protein kinase TYK2; Non-receptor tyrosine-protein kinase TYK2; OTTHUMP00000232745; OTTHUMP00000232746; OTTHUMP00000232748; Protein Tyrosine Kinase 2; TYK 2; Tyk2; TYK2_HUMAN; Tyrosine kinase 2
Target Background
This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also a component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with Immunodeficiency 35.
Notification