-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tyro3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human Tyro3 (NP_006284.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Tyro3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human Tyro3 (NP_006284.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05769A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TYRO3 |
| Target Synonyms | BYK; Dtk; RSE; Rek; Sky; Tif; Etk-2; Tyro3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-430 of human Tyro3 (NP_006284.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PATNYSLRVRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEAPLEGPLGPYKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDRAGQQGPPHSRTSWV | Uniprot ID | Q06418 |
Uniprot Id
Q06418
Target Species
Human
Target Name
TYRO3
Target Full Name
Tyrosine-protein kinase receptor TYRO3
Target Function
Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to several ligands including TULP1 or GAS6. Regulates many physiological processes including cell survival, migration and differentiation. Ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. Following activation by ligand, interacts with PIK3R1 and thereby enhances PI3-kinase activity. Activates the AKT survival pathway, including nuclear translocation of NF-kappa-B and up-regulation of transcription of NF-kappa-B-regulated genes. TYRO3 signaling plays a role in various processes such as neuron protection from excitotoxic injury, platelet aggregation and cytoskeleton reorganization. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.; (Microbial infection) Acts as a receptor for lassa virus and lymphocytic choriomeningitis virus, possibly through GAS6 binding to phosphatidyl-serine at the surface of virion envelope.; (Microbial infection) Acts as a receptor for Ebolavirus, possibly through GAS6 binding to phosphatidyl-serine at the surface of virion envelope.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, AXL/UFO subfamily
Target Tissue Specificity
Abundant in the brain and lower levels in other tissues.
Target Synonyms
Brt; BYK; DTK; Etk-2; protein tyrosine kinase 3; Rek; RSE; SKY; Tif; tyro3; TYRO3 protein tyrosine kinase; TYRO3_HUMAN; Tyrosine-protein kinase byk; Tyrosine-protein kinase DTK; Tyrosine-protein kinase receptor TYRO3; Tyrosine-protein kinase RSE; Tyrosine-protein kinase SKY; Tyrosine-protein kinase TIF
Target Background
The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in controlling cell survival and proliferation, spermatogenesis, immunoregulation and phagocytosis. The encoded protein has also been identified as a cell entry factor for Ebola and Marburg viruses.
Notification