Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tyrosine Hydroxylase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Tyrosine Hydroxylase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12120A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Tyrosine Hydroxylase |
| Target Synonyms | TYH; DYT14; DYT5b; Tyrosine Hydroxylase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG | Uniprot ID | P07101 |
Uniprot Id
P07101
Target Species
Human
Target Name
TH
Target Full Name
Tyrosine 3-monooxygenase
Target Function
Plays an important role in the physiology of adrenergic neurons. Positively regulates the regression of retinal hyaloid vessels during postnatal development.
Target Involvement
Segawa syndrome autosomal recessive (ARSEGS)
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Biopterin-dependent aromatic amino acid hydroxylase family
Target Tissue Specificity
Mainly expressed in the brain and adrenal glands.
Target Synonyms
Dystonia 14; DYT14; DYT5b; EC 1.14.16.2; OTTHUMP00000011225; OTTHUMP00000011226; ple; Protein Pale; TH; The; TY3H_HUMAN; TYH; Tyrosine 3 hydroxylase; Tyrosine 3 monooxygenase; Tyrosine 3-hydroxylase; Tyrosine 3-monooxygenase; Tyrosine hydroxylase
Target Background
The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
