Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TYSY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-313 of human TYSY (NP_001062.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against TYSY was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-313 of human TYSY (NP_001062.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13266A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TYSY |
| Target Synonyms | TS; TMS; DKCD; HST422; SY | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-313 of human TYSY (NP_001062.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV | Uniprot ID | P04818 |
Uniprot Id
P04818
Target Species
Human
Target Name
TYMS
Target Full Name
Thymidylate synthase
Target Function
Contributes to the de novo mitochondrial thymidylate biosynthesis pathway.
Target Subcellular Location
Nucleus. Cytoplasm. Mitochondrion. Mitochondrion matrix. Mitochondrion inner membrane.
Target Protein Families
Thymidylate synthase family
Target Synonyms
d TMP synthase; EC 2.1.1.45; HsT422; MGC88736; OTTHUMP00000162195; Thymidylate synthase; Thymidylate synthetase; TMS; TS; TSase; Tyms; TYMS protein; Tyms thymidylate synthetase; TYSY_HUMAN
Target Background
Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using, 10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occurring antisense transcript, mitochondrial enolase superfamily member 1 (GeneID:55556), vary inversely when cell-growth progresses from late-log to plateau phase. Polymorphisms in this gene may be associated with etiology of neoplasia, including breast cancer, and response to chemotherapy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
